Product Details
Human NEDD4 Family-Interacting Protein 1 (NDFIP1)
|
|
---|---|
Type: | Proteins |
Catalog Number: | PHN32468 |
Species: | Human |
Format: | Recombinant Protein |
Size: | 20 ug |
Purity: | > 90% by SDS - PAGE |
Source: | NDFIP1, 1-116 aa, Human, His tag, E.coli |
Presentation: | Liquid in 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol, 0.1M NaCl |
Sequence: | MGSSHHHHHHSSGLVPRGSHMGSMALALAALAAVEPACGSRYQQLQNEEESGEPEQAAGDAPPPYSSISAESAAYFDYKDESGFPKPPSYNVATTLPSYDEAERTKAEATIPLVPGRDEDFVGRDDFDDADQLRIGNDG |
Molecular Weight: | 15 kDa (139 aa) |
Storage: | -60C or below |
Research Area: | Cell Biology, Proteolysis, Ubiquitin, Epigenetics, Cell cycle |
Entrez Gene: | 80762 |
UniProt: | Q9BT67 |
Synonyms: | Nedd4 family interacting protein 1, N4WBP5, Breast cancer-associated protein SGA-1M, Breast cancer-associated protein SGA-1M, NEDD4 WW domain-binding protein 5, NEDD4 WW domain binding protein 5, Putative MAPK-activating protein PM13, Putative MAPK activating protein PM13, Putative NF-kappa-B-activating protein 164, Putative NF kappa B activating protein 164, Putative NFKB and MAPK-activating protein, Putative NFKB and MAPK activating protein, namesi, NDFIP1, PSEC0192, PSEC0223, NFIP1_HUMAN |